General Information

  • ID:  hor000092
  • Uniprot ID:  P01183
  • Protein name:  Lys-vasopressin
  • Gene name:  AVP
  • Organism:  Sus scrofa (Pig)
  • Family:  Vasopressin/oxytocin family
  • Source:  Animal
  • Expression:  hypothalamus
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005185 neurohypophyseal hormone activity; GO:0031894 V1A vasopressin receptor binding
  • GO BP:  GO:0007165 signal transduction; GO:0042310 vasoconstriction; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule

Sequence Information

  • Sequence:  CYFQNCPKG
  • Length:  9(20-28)
  • Propeptide:  MPDATLPACFLGLLALTSACYFQNCPKGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGASFLRRARASDRSNATLLDGPSGALLLRLVQLAGAPEPAEPAQPGVY
  • Signal peptide:  MPDATLPACFLGLLALTSA
  • Modification:  T9 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be involved in the control of sexual behavior
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  AVPR2, AVPR1A
  • Target Unid:   P32307, A0A286ZX01
  • IC50:  antidiuretic activity 408 IU/mg ( PubMed ID: 17258819 )
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  63.6 seconds ( PubMed ID: 17258821 )

Structure

  • Disulfide bond:  45663
  • Structure ID:  AF-P01183-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000092_AF2.pdbhor000092_ESM.pdb

Physical Information

Mass: 120210 Formula: C46H66N12O13S2
Absent amino acids: ADEHILMRSTVW Common amino acids: C
pI: 8.22 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 1
Hydrophobicity: -71.11 Boman Index: -1139
Half-Life / Aliphatic Index: 1.2 hour Aliphatic Index: 0
Instability Index: 1765.56 Extinction Coefficient cystines: 1615
Absorbance 280nm: 201.88

Literature

  • PubMed ID:  17258819
  • Title:  Partial purification and amino acid content of vasopressin from hog posterior pituitary glands.